DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cep97 and Dnal1

DIOPT Version :10

Sequence 1:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_083097.2 Gene:Dnal1 / 105000 MGIID:1921462 Length:190 Species:Mus musculus


Alignment Length:224 Identity:54/224 - (24%)
Similarity:87/224 - (38%) Gaps:65/224 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSKQKLKKVPKQDDAHSIRQLILDENELQKID-NIDSYLKIETLSLARNQLLRMYGVCRLHCLRE 78
            ||:.:.|...|..||..|: |......::|:| ::.:....|.|||:.|            |:.:
Mouse    11 LSRWEEKTGQKPSDAKEIK-LYAQIPPIEKMDASLSTLGNCEKLSLSTN------------CIEK 62

  Fly    79 LNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLN-TNVNLECLNLADNSIGSISDMSYLRNL 142
                   |.::.|||   :||:|:|..||||.:..|. ....||.|.::.|.|..:..:..::.|
Mouse    63 -------IANLNGLK---NLRILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKL 117

  Fly   143 KELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNLLSISIADNPCVTMINS 207
            |.||                        ::.|.:.|..|...|:.|..|..:....|| :...:|
Mouse   118 KILY------------------------MSNNLVKDWAEFLKLAELPCLEDLVFVGNP-LEEKHS 157

  Fly   208 LDGFDYRPFVLNW-------CMSLKYIDG 229
            .:|        ||       ...||.:||
Mouse   158 AEG--------NWIDEATKRVPKLKKLDG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380 6/15 (40%)
PPP1R42 13..229 CDD:455733 52/222 (23%)
leucine-rich repeat 32..53 CDD:275380 4/21 (19%)
leucine-rich repeat 76..97 CDD:275380 4/20 (20%)
leucine-rich repeat 98..119 CDD:275380 9/21 (43%)
leucine-rich repeat 120..141 CDD:275380 5/20 (25%)
leucine-rich repeat 142..165 CDD:275380 4/22 (18%)
leucine-rich repeat 166..190 CDD:275380 5/23 (22%)
IQ 581..599 CDD:197470
Dnal1NP_083097.2 PPP1R42 37..181 CDD:455733 46/197 (23%)
LRR 1 49..70 8/39 (21%)
leucine-rich repeat 50..71 CDD:275378 10/42 (24%)
LRR 2 71..92 9/20 (45%)
leucine-rich repeat 72..90 CDD:275378 9/17 (53%)
LRR 3 94..115 5/20 (25%)
leucine-rich repeat 95..116 CDD:275382 5/20 (25%)
LRR 4 116..137 7/44 (16%)
leucine-rich repeat 117..140 CDD:275382 8/46 (17%)
leucine-rich repeat 142..172 CDD:275382 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.