DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXQ1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_150285.3 Gene:FOXQ1 / 94234 HGNCID:20951 Length:403 Species:Homo sapiens


Alignment Length:443 Identity:126/443 - (28%)
Similarity:153/443 - (34%) Gaps:163/443 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HDEDEEEDVEKKSPAKFPPNHNNNNLNTTNWGSPEDHEAESDPESDLDVTSMSPA---------- 129
            |.:.:..|:|....:..|              ||.....:....||.|..:.|||          
Human    12 HGDKQGSDLEGAGGSDAP--------------SPLSAAGDDSLGSDGDCAANSPAAGGGARDTQG 62

  Fly   130 ---------PVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKKGNEKPPYSY 185
                     |.|  .|:.|.......|.|..|. |....|.....|.:|...|......||||||
Human    63 DGEQSAGGGPGA--EEAIPAAAAAAVVAEGAEA-GAAGPGAGGAGSGEGARSKPYTRRPKPPYSY 124

  Fly   186 NALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDP-G 249
            .|||.||||.|:..||||..|.||:|...|::|.:..||:||:|||||||.|||||.|....| |
Human   125 IALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWG 189

  Fly   250 KGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTYPPT 314
            |.|||||:|::|..|   :.|..|||     |.||:  .|:                     |..
Human   190 KDNYWMLNPNSEYTF---ADGVFRRR-----RKRLS--HRA---------------------PVP 223

  Fly   315 APSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGP----------------------- 356
            ||.|           .|:..||.|..||..|..|..|..:.|                       
Human   224 APGL-----------RPEEAPGLPAAPPPAPAAPASPRMRSPARQEERASPAGKFSSSFAIDSIL 277

  Fly   357 -------------PG-------PPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSV 401
                         ||       .|.||..|.|                    |...||..|.|..
Human   278 RKPFRSRRLRDTAPGTTLQWGAAPCPPLPAFP--------------------ALLPAAPCRALLP 322

  Fly   402 AAASAASQP----------PPTHHHPHLAVGQAPLSPGGDSPGPSP-QPLHKP 443
            ..|..|.:|          |||  .|.|.:  |||      |..:| :||..|
Human   323 LCAYGAGEPARLGAREAEVPPT--APPLLL--APL------PAAAPAKPLRGP 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 51/85 (60%)
FOXQ1NP_150285.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 14/78 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..116 5/21 (24%)
FH 119..197 CDD:238016 48/77 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..266 16/83 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.