DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FHL1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_015429.1 Gene:FHL1 / 856219 SGDID:S000006308 Length:936 Species:Saccharomyces cerevisiae


Alignment Length:231 Identity:61/231 - (26%)
Similarity:96/231 - (41%) Gaps:57/231 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ILPETVEHHDEDEEEDVEKKSPAKFPPNHN--NNNLNTTNWGSPEDHEAESDPESDLDVTS---- 125
            ||||.            |:...:|.|.|.:  .:.:||.|.       .:::|:|...:|:    
Yeast   381 ILPEQ------------ERNDDSKSPENADIAESEINTRNL-------KKNEPKSKKKITTGAKP 426

  Fly   126 --MSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKKGNEKPPYSYNAL 188
              ....|.....:..|....:.:..|:|..:..|                      ||..||:|:
Yeast   427 KKAQTKPAVKKEKKPPKIPKKVYTLEEIPVEYRT----------------------KPTVSYSAM 469

  Fly   189 IMMAIRQ-SSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGN 252
            :...||: |:.|.::|:.||..|....|||:....|||:|:||||||||.|.||.:.    |||.
Yeast   470 LTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKE----GKGW 530

  Fly   253 YWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFK 288
            .|.||   |:........|.::...|.::::.|..|
Yeast   531 LWGLD---EEYIAERERQKKKQSEIAVAKAQAAQLK 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 38/85 (45%)
FHL1NP_015429.1 COG5025 18..739 CDD:227358 61/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.