DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FKH1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_012135.1 Gene:FKH1 / 854675 SGDID:S000001393 Length:484 Species:Saccharomyces cerevisiae


Alignment Length:294 Identity:78/294 - (26%)
Similarity:124/294 - (42%) Gaps:45/294 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PLPPTTHHSALQSPHPV---GLNLTNLMKMARTPHLKSSFSINSILPETVEHHDEDEEEDVEKKS 87
            |..|.:..:.|||...:   |:.:..::....|  :.|.:.:|.::|:.:               
Yeast   143 PTGPDSPPTVLQSGCIIDIGGVQMIFILPEQET--IISDYCLNHLMPKLL--------------- 190

  Fly    88 PAKFPPNHNNNNL--NTTNWGSPEDHEAESDPESDLDVTSMSPAPVANPNESDP----------- 139
             :.:..|.|||.|  |... ||....|.....|:.|........|:::.::.:|           
Yeast   191 -STYGTNGNNNPLLRNIIE-GSTYLREQRLQEEARLQQLDHLHTPLSSSSDVNPIGDPHGDTIMM 253

  Fly   140 --DEVDEEFVEEDI-------ECDGETTDGDAENKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQ 195
              ||.||.:....|       ..:...|:|:..:..|......|:....|||.||.::|..||..
Yeast   254 EEDEEDENYTRGGIRPNTYTSSSNNAVTNGNVPHIENPSDLSLDENRYIKPPQSYASMITQAILS 318

  Fly   196 SSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWML-DPS 259
            :.|..::|..||::|..|:.:||.::..||||:||||||||.|.|||:.....|||..|.: |..
Yeast   319 TPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEV 383

  Fly   260 AEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIG 293
            ..|.....:.|||.:....||.:|......|..|
Yeast   384 RRDFLNKWNAGKLSKIRRGASVTRQLQLHMSKFG 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 38/85 (45%)
FKH1NP_012135.1 COG5025 1..484 CDD:227358 78/294 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I1615
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 1 1.000 - - X1751
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.