DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxb1b

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_571358.2 Gene:foxb1b / 799571 ZFINID:ZDB-GENE-990415-77 Length:296 Species:Danio rerio


Alignment Length:339 Identity:99/339 - (29%)
Similarity:132/339 - (38%) Gaps:113/339 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 KPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSL 234
            :|.::...::||||||.:|..|||:...||.|.|:.||::||...||||:|.|.||||:|||||.
Zfish     3 RPGRNTYSDQKPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSF 67

  Fly   235 NKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRR--------------TTAASRSRLA 285
            |.||:|:||..|.||||::|.|.||..|:|..||..:.|:|              ..|....:.|
Zfish    68 NDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVMISSEHLQKPSDAAHYLQQQA 132

  Fly   286 AFKRSLIGPMFPGLAAYPQFGQFLTYPPT---------------------APSLLASM---YQRY 326
            ..:.:.:|...|.:.:|   ...:|.|.|                     |.|.:.||   ||.:
Zfish   133 KLRMTALGTHLPQMTSY---NLSVTQPSTFKHPFAIENIIARDYKMPGSLAFSAMHSMSTGYQIH 194

  Fly   327 N-----------------PFAPKGGP----GHPGLPPGLPGLPGP--PGPQGPPGPPPPPFVAPP 368
            |                 .:|..|.|    .|..  ..||.:|.|  |.|...|..|        
Zfish   195 NQLTTAWPHMYSSNVIDAEYAAYGVPLKSLSHGA--QSLPAIPVPIKPAPASVPSIP-------- 249

  Fly   369 TSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPLSPGGDSP 433
                         .||.| ..|.|:...:.||                        |.||...:|
Zfish   250 -------------ALHAH-LPAFLSGSPQSLS------------------------PASPSQSNP 276

  Fly   434 G-PSPQPLHKPVTV 446
            . |||..|...|.|
Zfish   277 ATPSPTSLLHSVAV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 49/84 (58%)
foxb1bNP_571358.2 FH 13..101 CDD:214627 50/87 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.