Sequence 1: | NP_476834.1 | Gene: | slp2 / 33608 | FlyBaseID: | FBgn0004567 | Length: | 451 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001313317.1 | Gene: | foxj3 / 797147 | ZFINID: | ZDB-GENE-101005-1 | Length: | 596 | Species: | Danio rerio |
Alignment Length: | 393 | Identity: | 100/393 - (25%) |
---|---|---|---|
Similarity: | 137/393 - (34%) | Gaps: | 149/393 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 161 DAENKSNDGKPVKD-----------------KKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYE 208
Fly 209 YIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAE------------ 261
Fly 262 -------------------DVFIGGSTGKLRRRTTAASR------------------------SR 283
Fly 284 LAAFKRSLIGPM--FPGLAAYPQ--------------------------FGQFLTYPPTAPSLLA 320
Fly 321 SMY-QRYNPFAPKGGP------------------GHP---------GLPPGLPGLPGPPGPQGPP 357
Fly 358 GPPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHH--HPHLA 420
Fly 421 VGQ 423 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp2 | NP_476834.1 | Forkhead | 180..265 | CDD:306709 | 51/115 (44%) |
foxj3 | NP_001313317.1 | Forkhead | 62..139 | CDD:278670 | 49/76 (64%) |
SelP_N | <327..394 | CDD:282453 | 17/83 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |