DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxj3

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001313317.1 Gene:foxj3 / 797147 ZFINID:ZDB-GENE-101005-1 Length:596 Species:Danio rerio


Alignment Length:393 Identity:100/393 - (25%)
Similarity:137/393 - (34%) Gaps:149/393 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 DAENKSNDGKPVKD-----------------KKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYE 208
            ||:|....|.|.|.                 |.|  ||||||.:||..||..|.:|::||:.||:
Zfish    28 DAQNAHGPGMPKKSALLDPNTTLDQEEVQQHKDG--KPPYSYASLITFAINSSPKKKMTLSEIYQ 90

  Fly   209 YIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAE------------ 261
            :|..|.||||:...||:|||||||||||||:||||..||||||:||.:|.:.:            
Zfish    91 WICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDTLPTRPKKRP 155

  Fly   262 -------------------DVFIGGSTGKLRRRTTAASR------------------------SR 283
                               |..|.||........|..::                        ..
Zfish   156 RSGERASTPYSLESDNLGMDCIISGSASPTLAINTVTNKVALYNPDQDGSDSPRSSLNNSLSDQS 220

  Fly   284 LAAFKRSLIGPM--FPGLAAYPQ--------------------------FGQFLTYPPTAPSLLA 320
            ||:...:.:|.:  :..:.::|:                          |.:|.....:..||..
Zfish   221 LASVNLNSVGSVHSYTPVTSHPESVSQSMSLQQAPQAQYSIPDRDKQLLFSEFEDLSASFRSLYK 285

  Fly   321 SMY-QRYNPFAPKGGP------------------GHP---------GLPPGLPGLPGPPGPQGPP 357
            ::: |.||..:..|.|                  .||         ..|..:|.    .|.|.|.
Zfish   286 TVFEQSYNQQSLMGLPSESSQQTHTSCSYQHSPSSHPHNNQNSITNSHPNNIPN----NGSQVPL 346

  Fly   358 GPPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHH--HPHLA 420
            ..||......|....|.|...:.|  |.|.|.:....|           :..|..:.|  |.|.|
Zfish   347 SHPPHSAHNSPHGQHLSQHGPHSQ--HPHTAHSQHPQH-----------SQHPQHSQHSQHGHQA 398

  Fly   421 VGQ 423
            .||
Zfish   399 HGQ 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 51/115 (44%)
foxj3NP_001313317.1 Forkhead 62..139 CDD:278670 49/76 (64%)
SelP_N <327..394 CDD:282453 17/83 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.