DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxj1a

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001070174.2 Gene:foxj1a / 767737 ZFINID:ZDB-GENE-060929-1178 Length:458 Species:Danio rerio


Alignment Length:239 Identity:74/239 - (30%)
Similarity:101/239 - (42%) Gaps:58/239 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NLNTTNWGSPEDH------EAESDPESDLDVTSMSPAPVANPNESD------------------- 138
            |.:|....||..|      :|.|.|.:....:...|.....|..:.                   
Zfish    65 NASTGQHTSPSSHSHLMGSDAPSSPLAGDPASIGMPLTPGKPTAASFCRVPMFSALPSLVAHGHC 129

  Fly   139 PDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTL 203
            |||||                    .|||.         :.||||||..||.||::.|.:.::||
Zfish   130 PDEVD--------------------YKSNP---------HIKPPYSYATLICMAMQASKKTKITL 165

  Fly   204 NGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGS 268
            :.||::|..|..|:|.....|||||||||||||||:||||..|:||||.:|.:||...:..:..:
Zfish   166 SCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERLLNEA 230

  Fly   269 TGKLRR---RTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFL 309
            ..|.|.   :...|.:.|| .......|.:...|:..|:..|.|
Zfish   231 YKKRRLPPVQINPALQHRL-RMNAQATGVISRNLSVSPESQQLL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 46/84 (55%)
foxj1aNP_001070174.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..99 7/30 (23%)
Forkhead 142..228 CDD:278670 46/85 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.