DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxq1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_002934447.2 Gene:foxq1 / 733448 XenbaseID:XB-GENE-483842 Length:437 Species:Xenopus tropicalis


Alignment Length:470 Identity:123/470 - (26%)
Similarity:177/470 - (37%) Gaps:149/470 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NLMKMARTPHLKSSFSINSILPETVEHHDEDEEEDVEKKSPAKFPPNHNNNNLNTTNWGSPEDHE 112
            ||...|||.:      ::.:.|           .|.|...|:  |.:.....|     ||..|..
 Frog     2 NLAVFARTSY------VDKVCP-----------SDQEASLPS--PLSSRGEEL-----GSDGDFV 42

  Fly   113 AES--------DPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSN-- 167
            |.|        |.|.|.|..|:        ...:.|||:|| .|.:.|.:|.:.||..:.::.  
 Frog    43 ANSPNHVLCPRDCEMDTDTGSL--------GGDEEDEVEEE-EEVNPERNGVSADGSTQCRAQIV 98

  Fly   168 DGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNL 232
            :|...|......||||||.|||.|||:.|:..||||..|.:|:|...|::|.:..||:||:||||
 Frog    99 EGGKTKTYTRRPKPPYSYIALIAMAIKDSASGRLTLAEINDYLMKKFPFFRGSYTGWRNSVRHNL 163

  Fly   233 SLNKCFVKVPRHYDDP-GKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASR-------SRLAAFKR 289
            |||.|||||.|....| ||.|||||:|::|..|..|...:.|:|....::       ..||..:.
 Frog   164 SLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLNRVTKCLKEQDLQGLAEQQH 228

  Fly   290 SLIGPMFPGLAAYPQFGQFLTYPPTAP-----------------------------SLLASMYQR 325
            .::.|......:.|...: |...|:||                             |:|:..:||
 Frog   229 QMMNPTKASQGSSPSSSR-LIMAPSAPSSSSTNSSSNRSAKETNSGTKFSSSFAIESILSKPFQR 292

  Fly   326 Y----NPFA-------PKGGPGH-PGLPPGLP--------GLPGP-------------------- 350
            .    :|.:       |.|...| |...|..|        .||.|                    
 Frog   293 REREPDPRSSSGRILWPTGALLHSPSSAPSYPIVSYTPSTTLPAPSALYPISPLASNASSLHLQL 357

  Fly   351 --------------PGPQGPPGPPP-------------PPFVAPPTSSE-LYQRLQYQQLLHQHA 387
                          |..:|...|.|             |...:||.|:: |.::|...:||....
 Frog   358 YRYCMPEALLLLMDPRSEGHLSPDPRDDQLSHRVPPQHPHLFSPPCSTKTLSEQLGNPELLRTLR 422

  Fly   388 AAAALAAHQRQLSVA 402
            .|.|...::.:..:|
 Frog   423 TAGAYHPYRHETLLA 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 49/85 (58%)
foxq1XP_002934447.2 FH_FOXQ1-like 111..189 CDD:410808 46/77 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.