DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxl2a

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001038717.1 Gene:foxl2a / 692279 ZFINID:ZDB-GENE-060512-241 Length:306 Species:Danio rerio


Alignment Length:353 Identity:113/353 - (32%)
Similarity:145/353 - (41%) Gaps:125/353 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PNHNNNN---LNTTNWGSPEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECD 154
            |.|.:|.   ::||:..:.:|...:..|            |...|::|||               
Zfish     6 PGHEDNGMILMDTTSSSAEKDRTKDEAP------------PEKGPDKSDP--------------- 43

  Fly   155 GETTDGDAENKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRD 219
                                   .:||||||.|||.||||:||||||||:|||:||::..|:|..
Zfish    44 -----------------------TQKPPYSYVALIAMAIRESSEKRLTLSGIYQYIISKFPFYEK 85

  Fly   220 NKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRL 284
            ||:|||||||||||||:||:||||......|||||.|||:.||:|   ..|..|||         
Zfish    86 NKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMF---EKGNYRRR--------- 138

  Fly   285 AAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPP------G 343
                |.:..|..|              |||......|::         ||.|:..|.|      |
Zfish   139 ----RRMKRPFRP--------------PPTHFQPGKSLF---------GGEGYGYLSPPKYLQSG 176

  Fly   344 LPGLPGPPGP---------QGPPGPPPPPFVAPPTSSELYQRLQ----------YQQLL----HQ 385
            .......|.|         .|...|.....::.|:|...|.|:|          |..:.    |.
Zfish   177 FINNSWSPAPMSYTSCQVSSGSVSPVNMKGLSAPSSYNPYSRVQSIGLPSMVNSYNGISHHHHHH 241

  Fly   386 HAAAAALAAHQRQLSVAAASAASQPPPT 413
            |....|| .|.:|||.|.|:|   ||.|
Zfish   242 HTHPHAL-PHAQQLSPATAAA---PPVT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 59/84 (70%)
foxl2aNP_001038717.1 Forkhead 46..131 CDD:306709 60/87 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.