DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxl1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_006255788.1 Gene:Foxl1 / 687553 RGDID:1584212 Length:341 Species:Rattus norvegicus


Alignment Length:289 Identity:98/289 - (33%)
Similarity:131/289 - (45%) Gaps:66/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 EKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPR 243
            :||||||.|||.|||:.:.|:|:||||||::||...|:|.||:||||||||||||||:|||||||
  Rat    48 QKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFVKVPR 112

  Fly   244 HYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPM---------FPGL 299
            ....||||:||.|||...|:|..|:..:.:|:...|:.|..|  ||:.:.|.         .|.|
  Rat   113 EKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPAAGSPEA--KRTRVEPRESEVGCDVGSPNL 175

  Fly   300 A-AYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQ--GPPGPPP 361
            | |.|......:..|.|                 ||.....|.|.       |||:  .|.....
  Rat   176 ATARPMHEPDRSQSPAA-----------------GGTARSALLPW-------PGPELRDPDADRT 216

  Fly   362 PPFVAPPTSSELYQRLQYQQLLHQHAAA--------------------AALAAHQRQLSVAAASA 406
            ........|.:|.:.:.|.  :|...::                    :.||...:..|.|.|..
  Rat   217 IQDAGAVASGQLERPVHYP--VHHLGSSLRPAPSGSPKGSKSKSFSIDSILAVRPKPASGAEAPG 279

  Fly   407 ASQPPPTHHHPHLAVGQAPLSPGGDSPGP 435
            .|:|.|.      |:|.:.|:.....|.|
  Rat   280 ISKPLPG------ALGSSLLTASSGLPPP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 57/84 (68%)
Foxl1XP_006255788.1 FH 49..137 CDD:214627 58/87 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.