DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxl3

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_038945901.1 Gene:Foxl3 / 680273 RGDID:1594158 Length:216 Species:Rattus norvegicus


Alignment Length:259 Identity:88/259 - (33%)
Similarity:105/259 - (40%) Gaps:88/259 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 NKSNDGKP---VKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQ 225
            |...|..|   ..::|...:|.|||.|||.|||:||...|:||:|||::||...||||.|::.||
  Rat    13 NDDADDYPAGSADEEKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQRAWQ 77

  Fly   226 NSIRHNLSLNKCFVKVPR---HYDDPGKGNYWMLDPSAE---DVFIGGSTGKLRRRTTAASRSRL 284
            ||||||||||.|||||||   |  |.||||||......|   |:|..|:..:.|||....|..  
  Rat    78 NSIRHNLSLNSCFVKVPRTEGH--DKGKGNYWTFAGGCESLLDLFENGNFRRRRRRRGPKSEE-- 138

  Fly   285 AAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPG 349
                                                         ||  ||    |.|...|.||
  Rat   139 ---------------------------------------------AP--GP----LQPAARGSPG 152

  Fly   350 PPGPQGP----------------------PGPPPPPFVAPPTSSE--LYQRLQYQQLLHQHAAA 389
            |.|.|.|                      ..|.|.|.:.....|:  .|..|:.||:..|..||
  Rat   153 PDGTQAPDREAQARLVTHRDIKFSIDYILSSPDPFPVLRSSCHSQEARYPTLEPQQMSFQFWAA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 54/90 (60%)
Foxl3XP_038945901.1 Forkhead 32..115 CDD:395192 52/84 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.