DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXL2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_075555.1 Gene:FOXL2 / 668 HGNCID:1092 Length:376 Species:Homo sapiens


Alignment Length:346 Identity:124/346 - (35%)
Similarity:153/346 - (44%) Gaps:96/346 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 KSNDGKPVKDKKGN--------------EKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHP 215
            |..:|.|....||.              :||||||.|||.||||:|:||||||:|||:||:...|
Human    25 KEPEGPPPSPGKGGGGGGGTAPEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFP 89

  Fly   216 YYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAAS 280
            :|..||:|||||||||||||:||:||||......|||||.|||:.||:|..|:. :.|||.....
Human    90 FYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNY-RRRRRMKRPF 153

  Fly   281 RSRLAAFK--RSLIGPMFP--------------GLAAYPQFGQ--FL--TYP--------PTAPS 317
            |...|.|:  :.|.|....              |..|.|::.|  ||  ::|        |.|..
Human   154 RPPPAHFQPGKGLFGAGGAAGGCGVAGAGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASC 218

  Fly   318 LLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQG----------PPG-------------- 358
            .:|:........|...|||.||....:.||.||....|          |||              
Human   219 QMAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYTRVQSMALPPGVVNSYNGLGGPPAA 283

  Fly   359 PPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQ 423
            |||||...|           :....|.|||||...|....       .|:.|||         ||
Human   284 PPPPPHPHP-----------HPHAHHLHAAAAPPPAPPHH-------GAAAPPP---------GQ 321

  Fly   424 -APLSPGGDSPGPSPQPLHKP 443
             :|.||...:| |:|.|...|
Human   322 LSPASPATAAP-PAPAPTSAP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 58/84 (69%)
FOXL2NP_075555.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 5/27 (19%)
Forkhead 53..139 CDD:365978 58/85 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..342 27/94 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.