DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxq1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_074049.2 Gene:Foxq1 / 64826 RGDID:621572 Length:400 Species:Rattus norvegicus


Alignment Length:400 Identity:113/400 - (28%)
Similarity:138/400 - (34%) Gaps:140/400 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HDEDEEEDVEKKSPAKFPPNHNNNNLNTTNWGSPEDHEAESDPESDLDVTSMSPAP--------- 130
            |.:....|:|....:..|              ||.....:....||.|..:.|||.         
  Rat    12 HGDKMGSDLEGAGSSDVP--------------SPLSAAGDDSLGSDGDCAANSPAAGRGAVDLEG 62

  Fly   131 -VANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKKGNE-----------KPPY 183
             ....|.|......:         |.|.|||.....|..|.......|.|           ||||
  Rat    63 GGGERNSSGGASTQD---------DPEVTDGSRTQASPVGPCAGSVGGGEGARSKPYTRRPKPPY 118

  Fly   184 SYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDP 248
            ||.|||.||||.|:..||||..|.||:|...|::|.:..||:||:|||||||.|||||.|....|
  Rat   119 SYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRP 183

  Fly   249 -GKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTYP 312
             ||.|||||:|::|..|   :.|..|||     |.||:  .|:.:.                   
  Rat   184 WGKDNYWMLNPNSEYTF---ADGVFRRR-----RKRLS--HRTTVS------------------- 219

  Fly   313 PTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPPPFVAPPTSSELYQRL 377
                   ||                 ||.|.    ..||||.|.|.|.|....:|...|...|. 
  Rat   220 -------AS-----------------GLRPE----EAPPGPAGTPQPAPTAGSSPIARSPARQE- 255

  Fly   378 QYQQLLHQHAAAAALAAHQRQLSVAAASAASQP----------------------PPTHHHPHLA 420
                       ..:..|.:...|.|..|..|:|                      ||...:|.| 
  Rat   256 -----------EGSSPASKFSSSFAIDSILSKPFRSRRDGDPALGVQLPWSAAPCPPLRAYPAL- 308

  Fly   421 VGQAPLSPGG 430
               .|.|.||
  Rat   309 ---LPASSGG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 51/85 (60%)
Foxq1NP_074049.2 FH 115..193 CDD:238016 48/77 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.