DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxg1c

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001038680.1 Gene:foxg1c / 571323 ZFINID:ZDB-GENE-050419-26 Length:379 Species:Danio rerio


Alignment Length:405 Identity:152/405 - (37%)
Similarity:182/405 - (44%) Gaps:135/405 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KSSFSINSILPETVEHHDEDEEEDVEKKSPAKFPPNHNNNNLNTTNWGSPEDHEAESDPESDLDV 123
            ||||||:|:|   :.|.....:.....:|.:..||         .....|.|             
Zfish    13 KSSFSISSLL---LRHERARSDAQEAPRSRSAKPP---------ARCHQPAD------------- 52

  Fly   124 TSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKKGN-EKPPYSYNA 187
                 .||...||              :....|..||..|.|. :|..|.:||.. :|||:||||
Zfish    53 -----KPVRERNE--------------LVTRTEKKDGVGEPKC-EGTDVPEKKSKPDKPPFSYNA 97

  Fly   188 LIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGN 252
            |||||||||.|:|||||||||:||.|.||||:|:|||||||||||||||||||||||||||||||
Zfish    98 LIMMAIRQSPERRLTLNGIYEFIMGNFPYYRENRQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGN 162

  Fly   253 YWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPS 317
            |||||||::||||||:|||||||:|||||::| |.||   |......||           ....:
Zfish   163 YWMLDPSSDDVFIGGTTGKLRRRSTAASRAKL-AMKR---GARLSSTAA-----------SAGLA 212

  Fly   318 LLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPPPFVAPPTSSELYQRLQYQQL 382
            ...|.|.                                   |.||||.               |
Zfish   213 FAGSFYW-----------------------------------PVPPFVT---------------L 227

  Fly   383 LHQHAAAAALAAHQRQLSVAAASAASQP----------------PPTHHHPHLAVGQAPLSPGGD 431
            .|:|::.|  |||.   |..|||..||.                |.:....:..:|...::....
Zfish   228 QHRHSSPA--AAHH---SNYAASVLSQSARHFSSVAPAAERLLIPSSQEATYYGMGCEQMTSSSS 287

  Fly   432 SPGPS---PQPLHKP 443
            |...|   |.||..|
Zfish   288 SFSTSASVPLPLSAP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 74/84 (88%)
foxg1cNP_001038680.1 FH 90..178 CDD:214627 77/87 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 172 1.000 Domainoid score I3672
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3533
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm25551
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1751
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.