DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxf1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001073655.1 Gene:foxf1 / 566407 ZFINID:ZDB-GENE-050419-153 Length:380 Species:Danio rerio


Alignment Length:340 Identity:106/340 - (31%)
Similarity:151/340 - (44%) Gaps:70/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 VANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDG--KPVKDKKGNEKPPYSYNALIMMAI 193
            |..|..|.|  :.|:.|:..:.....::......|:|.|  :|       |||||||.|||:|||
Zfish    10 VQTPAHSSP--MTEKPVQTPVMETSSSSSSTKAKKTNAGIRRP-------EKPPYSYIALIVMAI 65

  Fly   194 RQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDP 258
            :.|..|||||:.||:::.:..|::|.:.|||:||:|||||||:||:|:|:....||||:||.:||
Zfish    66 QSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDP 130

  Fly   259 SAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPM-------FPGLAAYPQFGQFLTYPPTAP 316
            ::|.:|..||.    ||.....|.:..|.|.|:...|       .|....:...|..|:.||.:.
Zfish   131 ASEFMFEEGSF----RRRPRGFRRKCQALKPSMYSMMNGLGFNHIPESYNFQGGGGGLSCPPNSL 191

  Fly   317 SLLASMYQRYNPFAPK----GGPGHPGLPPGLPGLPGPPGPQ------GPPGPPPPPFVAPPTSS 371
            ||.:.:.......|..    |..||     .:|.|....|..      |..|...|         
Zfish   192 SLESGIGMMNGHLASNMEGMGLAGH-----SMPHLSTNSGHSYMGSCTGSSGTEYP--------- 242

  Fly   372 ELYQRLQYQQLLHQHAAAAALAA-------HQRQLSVAAASAASQPPPTHHHPHLAVGQAPLS-- 427
                        |..::|:.|..       |....|.|:| ..|.||.:.::....:.|.|||  
Zfish   243 ------------HHDSSASPLLTSGGVMDPHAVYSSTASA-WPSAPPTSLNNGTSYIKQQPLSPC 294

  Fly   428 -PGGDSPGPSPQPLH 441
             ||..|..|| .|.|
Zfish   295 NPGASSLQPS-LPTH 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 47/84 (56%)
foxf1NP_001073655.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 9/40 (23%)
FH 52..140 CDD:214627 48/87 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.