DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxq2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001098411.1 Gene:foxq2 / 565796 ZFINID:ZDB-GENE-050208-663 Length:244 Species:Danio rerio


Alignment Length:218 Identity:77/218 - (35%)
Similarity:105/218 - (48%) Gaps:41/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 PEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPV 172
            |||:   .:|..||..|      |..|.:....|.|.|..||      :..|.|.||..     |
Zfish    35 PEDN---VNPSEDLQST------VNEPEQKTLSEQDSEKSEE------QENDEDHENTH-----V 79

  Fly   173 KDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKC 237
            |.:..:|||..||.|||.|||..|.||:|.|..||::||.::||::...:.|:||:|||||||:|
Zfish    80 KSEGTDEKPAQSYIALISMAILDSDEKKLLLCDIYQWIMDHYPYFKSKDKNWRNSVRHNLSLNEC 144

  Fly   238 FVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLR-----RRTTA-------ASRSRLAAFKRS 290
            |:|..|  .|.|||::|.:.|:....|..|...:.|     ||.|.       |....|...||:
Zfish   145 FIKAGR--SDNGKGHFWAIHPANFQDFSNGDYHRRRARRRIRRVTGQLPYALPAHYQTLGRLKRT 207

  Fly   291 LIGPMFPGLAAYPQFGQFLTYPP 313
               |.:....::|    .|.:||
Zfish   208 ---PCWCCPPSHP----LLCFPP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 41/84 (49%)
foxq2NP_001098411.1 Forkhead 87..171 CDD:278670 42/85 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.