DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxn2b

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001017555.2 Gene:foxn2b / 550127 ZFINID:ZDB-GENE-050417-1 Length:396 Species:Danio rerio


Alignment Length:239 Identity:69/239 - (28%)
Similarity:96/239 - (40%) Gaps:65/239 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 PEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVD----------EEF---------------- 146
            ||...|.|...:.||....|.:.||  .||:.||:.          :.|                
Zfish    36 PEAESASSPMATSLDQIGRSVSVVA--GESEDDELTNLNWLHENLLQNFSLGGPEAQPINSPLFD 98

  Fly   147 VEEDIECDGETTDGDAENKS--NDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEY 209
            :|..|......|:..|.:.|  ::..|.|     .|||:|::.||.|||.||..|.|.:..||.:
Zfish    99 IEGGIGSPHSNTNSSASSVSTGSERDPYK-----SKPPFSFSLLIYMAIEQSPSKSLPVKDIYGW 158

  Fly   210 IMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDP-GKGNYWMLDPSAEDVFIGGSTGKLR 273
            |:.:.||:.....||:||:||||||||||.||.|..... |||:.|.:.|....:.         
Zfish   159 ILKHFPYFSSAPTGWKNSVRHNLSLNKCFRKVERSIGKTNGKGSLWCVHPEFRPML--------- 214

  Fly   274 RRTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPS 317
                      :.|.|:.          .:|....|.|.|.:.||
Zfish   215 ----------MQALKKQ----------HFPNAHAFCTPPASPPS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 40/85 (47%)
foxn2bNP_001017555.2 Forkhead 129..216 CDD:278670 40/105 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.