Sequence 1: | NP_476834.1 | Gene: | slp2 / 33608 | FlyBaseID: | FBgn0004567 | Length: | 451 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017084.1 | Gene: | foxh1 / 549838 | XenbaseID: | XB-GENE-1194372 | Length: | 515 | Species: | Xenopus tropicalis |
Alignment Length: | 202 | Identity: | 63/202 - (31%) |
---|---|---|---|
Similarity: | 90/202 - (44%) | Gaps: | 45/202 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 154 DGETTDGDAENKSNDGKPV---KDKKGN----EKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIM 211
Fly 212 TNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPG----KGNYWMLDPSAEDVFIGGSTGKL 272
Fly 273 RRRTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPSLLASMYQRYN--PFAPKGGP 335
Fly 336 GHPGLPP 342 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp2 | NP_476834.1 | Forkhead | 180..265 | CDD:306709 | 41/88 (47%) |
foxh1 | NP_001017084.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 55..103 | 6/25 (24%) | |
FH | 110..188 | CDD:238016 | 39/80 (49%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 307..399 | ||||
SMAD-interaction domain (SID) | 377..503 | ||||
Fast/FoxH1 motif 1 (FM1). /evidence=ECO:0000255 | 402..406 | ||||
Fast/FoxH1 motif 2 (FM2). /evidence=ECO:0000255 | 412..418 | ||||
SMAD-interaction motif (SIM) | 467..488 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |