DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxh1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001017084.1 Gene:foxh1 / 549838 XenbaseID:XB-GENE-1194372 Length:515 Species:Xenopus tropicalis


Alignment Length:202 Identity:63/202 - (31%)
Similarity:90/202 - (44%) Gaps:45/202 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 DGETTDGDAENKSNDGKPV---KDKKGN----EKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIM 211
            :|..|..:....|..|...   |.||.|    .||||||.|:|.:.|:.|.||||.|:.|.:.:.
 Frog    77 EGSCTQAEGTKDSLGGDETLSRKSKKKNYHRYAKPPYSYLAMIALVIQNSPEKRLKLSQILKEVS 141

  Fly   212 TNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPG----KGNYWMLDPSAEDVFIGGSTGKL 272
            |..|:::.:..||::|||||||.|.||.||.:   |||    |||:|.:|.|...:      ..:
 Frog   142 TLFPFFKGDYMGWKDSIRHNLSSNDCFKKVLK---DPGKPQAKGNFWTVDVSRIPL------DAM 197

  Fly   273 RRRTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPSLLASMYQRYN--PFAPKGGP 335
            :.:.||.:|.....|.:.|                       ||.:|.:....:|  .:||...|
 Frog   198 KLQNTALTRGGSDYFVQDL-----------------------APYILHNYKYEHNVVVYAPHHMP 239

  Fly   336 GHPGLPP 342
            .|....|
 Frog   240 SHASSLP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 41/88 (47%)
foxh1NP_001017084.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..103 6/25 (24%)
FH 110..188 CDD:238016 39/80 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 307..399
SMAD-interaction domain (SID) 377..503
Fast/FoxH1 motif 1 (FM1). /evidence=ECO:0000255 402..406
Fast/FoxH1 motif 2 (FM2). /evidence=ECO:0000255 412..418
SMAD-interaction motif (SIM) 467..488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.