DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxd4l1.1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001016928.1 Gene:foxd4l1.1 / 549682 XenbaseID:XB-GENE-479247 Length:352 Species:Xenopus tropicalis


Alignment Length:393 Identity:105/393 - (26%)
Similarity:146/393 - (37%) Gaps:154/393 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SILPETVEHHDEDEEEDVEKKSPAKFPPNHNNNNLNTTNWGSPEDHEAESDPESDLDV------- 123
            |:..|:..|||                               |:|:...||.|.::|:       
 Frog     2 SLSQESGAHHD-------------------------------PQDYPVVSDEEDEIDILGEDDSC 35

  Fly   124 ------------TSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKK 176
                        :.|..:.:.:|::.       ...|.:.:..||:..|.:::........|.|:
 Frog    36 SLKSHFYLQPTHSEMGDSGILSPSKL-------SCTESESDSSGESEGGTSKDSPATPSGGKAKR 93

  Fly   177 GNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKV 241
            ...||||||.|||.|||.||..|:|||:||.::|.:..|||:|....||||||||||||.||:|:
 Frog    94 ALVKPPYSYIALITMAILQSPHKKLTLSGICDFISSKFPYYKDKFPAWQNSIRHNLSLNDCFIKI 158

  Fly   242 PRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPGLAAYPQFG 306
            ||...:|||||||.|||::||:|..||..:.|:|   ..|.:...||..|:              
 Frog   159 PREPGNPGKGNYWTLDPASEDMFDNGSFLRRRKR---FKRHQQEFFKDGLV-------------- 206

  Fly   307 QFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPPPFVAPPTSS 371
                              .|||.                                 |:..|    
 Frog   207 ------------------MYNPL---------------------------------PYYRP---- 216

  Fly   372 ELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPLSPGGDSPGPS 436
              |..:|.||:|.|  ...|..|....|::          |||           |||..|.....
 Frog   217 --YSTIQPQQVLQQ--TPVACMAIPENLTM----------PTH-----------LSPYPDIKRKV 256

  Fly   437 PQP 439
            |.|
 Frog   257 PYP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 54/84 (64%)
foxd4l1.1NP_001016928.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 11/60 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..92 7/51 (14%)
Forkhead 97..183 CDD:278670 55/85 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.