DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxj2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_006237373.1 Gene:Foxj2 / 502886 RGDID:1565101 Length:623 Species:Rattus norvegicus


Alignment Length:368 Identity:105/368 - (28%)
Similarity:136/368 - (36%) Gaps:141/368 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 GETTDGDAENKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRD 219
            |..||.:|....::....:|    .||.|||..||..||..|..|::||:.||.:|..|.|||::
  Rat    85 GSPTDPNATLSKDEASVHQD----GKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKN 145

  Fly   220 NKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRL 284
            ...||:|||||||||||||.||||..||||||:||.:| :..|:                ||.| 
  Rat   146 AGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTID-TCPDI----------------SRKR- 192

  Fly   285 AAFKRSLIGPMFPGLAAYPQFGQFLTYPP------TAPSLLASMYQRYNPFAPKGG-PG------ 336
                                     .:||      .:|...||.       :|:|| ||      
  Rat   193 -------------------------RHPPDDDLSQDSPEQEASK-------SPRGGVPGSGEASL 225

  Fly   337 -HPGLP----------------PG-LPG---LPGPPGPQGPPGPPP------------------- 361
             |.|.|                || :.|   ..|.||.:...|.||                   
  Rat   226 SHEGNPQMSLQSPSSMASYSQGPGPVDGGAVAAGAPGQESTEGAPPLYNTNHDFKFSYSEINFQD 290

  Fly   362 --------------------PPFVA-----PPTSS-ELYQRLQYQQLLHQHAAAAALAAHQRQLS 400
                                ..|.:     ||::: .:||:.|.||...|...    ...|:|..
  Rat   291 LSWSFRNLYKSMLERSSSSQHGFSSLLGDMPPSNNYYMYQQQQQQQQQQQQQQ----QQQQQQQQ 351

  Fly   401 VAAASAASQPPPTHHHPHLAVGQAPLSPGGDSPGPSPQPLHKP 443
            ........||||....|...  ||| :.|..:.|.:| |||.|
  Rat   352 QQQPPPQPQPPPQQPQPQQQ--QAP-TQGPSNVGGAP-PLHTP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 49/84 (58%)
Foxj2XP_006237373.1 Forkhead 106..183 CDD:278670 47/76 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.