DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxi3

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001102819.1 Gene:Foxi3 / 502846 RGDID:1561816 Length:400 Species:Rattus norvegicus


Alignment Length:303 Identity:98/303 - (32%)
Similarity:128/303 - (42%) Gaps:91/303 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRH 244
            :|||||:|||.|||:.:.|::|||:.||:::..|.|:|:.:|.|||||||||||||.||.||||.
  Rat   131 RPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLNDCFKKVPRD 195

  Fly   245 YDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAAS---------------RSRLAAFKR----- 289
            .|||||||||.|||:.|.:|..|:..:.|||...||               .|||....:     
  Rat   196 EDDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRAEASSNLTVPSGTSKSDGQSSRLRVSGKLEGDS 260

  Fly   290 --SLIGP--------------MFPG---LAAYPQFGQFLTYPPTAPSLLASM-YQRYNPFAPKGG 334
              |::.|              ..||   |.:.|....||:...|.....:|| .||..|    |.
  Rat   261 PSSMLRPSQSPEPPEGTKSTASSPGASTLTSTPCLNTFLSSFNTLSVNASSMSTQRTLP----GS 321

  Fly   335 PGHPGLPPGLPGLPGPPGPQGPPGPPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQL 399
            ..|||            |.|.|.....|....|.:|.:..|                        
  Rat   322 RRHPG------------GTQLPSSTTFPSTSIPDSSLDSVQ------------------------ 350

  Fly   400 SVAAASAASQPPPTHHHPHLAVGQAPLSPG-GDSPGPSPQPLH 441
             ::.....||         |:...:|.|.| ||...|...|.:
  Rat   351 -LSTVGGGSQ---------LSSYYSPFSGGSGDQSSPFGSPFY 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 53/84 (63%)
Foxi3NP_001102819.1 Forkhead 131..217 CDD:278670 54/85 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.