DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxd3

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001011383.1 Gene:foxd3 / 496851 XenbaseID:XB-GENE-487289 Length:369 Species:Xenopus tropicalis


Alignment Length:411 Identity:131/411 - (31%)
Similarity:173/411 - (42%) Gaps:110/411 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LKSSFSINSILPETVEHHDE-------DEEEDVEKKSPAKFPPNHNNNNLNTTNWGSPEDHEAES 115
            |..|.|.:.:..:||...|:       :.:|.::|.|..                |||..|..|:
 Frog     3 LSGSSSASDMSGQTVLSADDADIDVVGEGDEPLDKDSEC----------------GSPAGHAEEA 51

  Fly   116 DPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKKGNEK 180
            |   :|....::.:|..:.||:                     :|..|::..:|...|.|....|
 Frog    52 D---ELGGKEIARSPSGSANEA---------------------EGKGESQQQEGMQNKPKNSLVK 92

  Fly   181 PPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHY 245
            |||||.|||.|||.||.:|:|||:||.|:|....||||:....||||||||||||.||||:||..
 Frog    93 PPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREP 157

  Fly   246 DDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLT 310
            .:|||||||.|||.:||:|..||..:.|:|           |||.                    
 Frog   158 GNPGKGNYWTLDPQSEDMFDNGSFLRRRKR-----------FKRQ-------------------- 191

  Fly   311 YPPTAPSLLASMYQRYNPFAPKGGPGHP-GLPPG---------LPGLPGPPGPQGPPGPPPPPFV 365
            .|.:.....|.|.|.:..::..|..|.| ||.|.         .|.:| |.||..||..|..|  
 Frog   192 QPDSLREQTALMMQSFGAYSLAGPYGRPYGLHPAAYTHPAALQYPYIP-PVGPMLPPAVPLLP-- 253

  Fly   366 APPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPLSPGG 430
                ||||.::....||      :.:|......||..|||.....|.:  .|..::....    |
 Frog   254 ----SSELSRKAFSSQL------SPSLQLQLSSLSSTAASIIKSEPSS--RPSFSIENII----G 302

  Fly   431 DSPGPSPQP---LHKPVTVVS 448
            .|...|..|   |..||||.|
 Frog   303 VSAASSIAPQTFLRPPVTVQS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 56/84 (67%)
foxd3NP_001011383.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 24/125 (19%)
Forkhead 92..177 CDD:365978 56/84 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.