DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxj1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_012827170.1 Gene:foxj1 / 496834 XenbaseID:XB-GENE-853648 Length:512 Species:Xenopus tropicalis


Alignment Length:124 Identity:56/124 - (45%)
Similarity:72/124 - (58%) Gaps:19/124 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 GKPVK-----------------DKKGNE--KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNH 214
            |||:.                 |.|.|.  ||||||..||.||::.|.:.::||:.||::|..|.
 Frog   167 GKPISSSTSRASHLGLQPMEDIDYKTNPHVKPPYSYATLICMAMQASKKTKITLSAIYKWITDNF 231

  Fly   215 PYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLR 273
            .|:|.....|||||||||||||||:||||..|:||||.:|.:||...|..:.|:..|.|
 Frog   232 CYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWKIDPQYADRLMNGAMKKRR 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 47/84 (56%)
foxj1XP_012827170.1 Forkhead 197..283 CDD:278670 47/85 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.