DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxj1b

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001008648.1 Gene:foxj1b / 494105 ZFINID:ZDB-GENE-041212-76 Length:442 Species:Danio rerio


Alignment Length:256 Identity:88/256 - (34%)
Similarity:122/256 - (47%) Gaps:48/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NLTNLMKMARTPHLKSSFSINSILPETVEHHDEDEEEDVEKKSPAK-FPPNH---NNNNLNTTNW 105
            :||:|       |...:|||.|..||               ::|:. ..|.|   ..|.|..|: 
Zfish    37 SLTSL-------HWLQNFSILSANPE---------------RTPSSGCHPQHLFYYKNQLGGTD- 78

  Fly   106 GSPEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGK 170
             ||     .|.|..|...|.|...| .||..|.....:...:::    .|:...|    ::|..:
Zfish    79 -SP-----SSPPAGDTAATGMPQTP-GNPTTSCSSLANPYALQQ----AGQYITG----QTNPAE 128

  Fly   171 PVKDKKGNE--KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLS 233
            .: |.|.|.  ||||||..||.||::.|::.::||:.||.:|..|..|||..:..||||||||||
Zfish   129 EI-DYKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLS 192

  Fly   234 LNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGP 294
            |||||:||||..|:||||.:|.:||...|:|:   .|..:||...|:........:.|..|
Zfish   193 LNKCFMKVPRQKDEPGKGGFWQIDPQYADMFV---NGVFKRRRMPATNFNTQRQSKMLSSP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 48/84 (57%)
foxj1bNP_001008648.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..106 13/40 (33%)
Forkhead 139..225 CDD:278670 49/88 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.