DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxc1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001007864.1 Gene:foxc1 / 493250 XenbaseID:XB-GENE-479055 Length:495 Species:Xenopus tropicalis


Alignment Length:288 Identity:98/288 - (34%)
Similarity:125/288 - (43%) Gaps:59/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 PVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLN 235
            |....|...||||||.|||.|||:.:.||::||||||::||...|:|||||||||||||||||||
 Frog    70 PQPQPKDMVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLN 134

  Fly   236 KCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRR---------TTAASRSRLAAFKRSL 291
            :|||||||....||||:||.|||.:.::|..||..:.|||         .|...:.||       
 Frog   135 ECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVVKDATKEDKDRL------- 192

  Fly   292 IGPMFPGLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPP-------GLPGLPG 349
                            ...:..:.|:  |:..||.............|..|       ...|...
 Frog   193 ----------------LKEHHGSQPA--AAQQQRQQQQGQAQAEQDSGSQPVRIQDIKTENGTSS 239

  Fly   350 PPGPQGPPGPPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTH 414
            ||....|.....|...:|.:||.:            .:.:.......|.:|:.||. :..|...|
 Frog   240 PPQAMSPALSTVPKIESPDSSSSM------------SSGSPHSIPSNRSMSLEAAE-SHHPHQQH 291

  Fly   415 HHPH-LAVGQAPL----SPGGDSPGPSP 437
            ||.. .:|.....    ||.|....|||
 Frog   292 HHSQGFSVDNIMTSLRGSPQGSGELPSP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 58/84 (69%)
foxc1NP_001007864.1 Forkhead 79..164 CDD:365978 58/84 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..322 32/183 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.