DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxj2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_031760837.1 Gene:foxj2 / 448174 XenbaseID:XB-GENE-483646 Length:522 Species:Xenopus tropicalis


Alignment Length:336 Identity:105/336 - (31%)
Similarity:135/336 - (40%) Gaps:95/336 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 GETTDGDAENKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRD 219
            |..||..|.....:....:|    .||||||..||..||..:..||:||:.||.:|..|.||||:
 Frog    48 GSPTDPSAMLSKEEAAAHRD----GKPPYSYANLIQYAINSAPAKRMTLSEIYRWICDNFPYYRN 108

  Fly   220 NKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDP-SAEDVFIGGSTGKLRRRTTAASRSR 283
            ...||:|||||||||||||.||||..||||||:|||:|. ..|||       .|.||        
 Frog   109 AGVGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWMIDSCPKEDV-------ALPRR-------- 158

  Fly   284 LAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLP 348
                ||    |......:...|.|.:...|...:...||.|       :|..||    |.....|
 Frog   159 ----KR----PHPDDEVSQDSFEQDVNKSPLRSASEVSMPQ-------EGTQGH----PMNNNSP 204

  Fly   349 GPPGPQGPPGPPPPPFVAPPTSS-------------------------------------ELYQR 376
            .|...|..|...||...||..::                                     :||..
 Frog   205 LPSYSQANPTQMPPDSRAPTYNNNDCYKFSFSESTFPDLGCSFRSLYHSLLGKQGERGDKDLYNS 269

  Fly   377 LQYQQLL---HQHAAAAALAAHQRQLSVAAAS-------AASQPPPTHHH------PHLAVGQAP 425
            :|.:|:|   |....:::...:|:....|.::       :.|.|||.||.      |:|...|.|
 Frog   270 MQSKQVLPPVHSEVQSSSCCMYQQNSGAAPSNLHPHNVPSISGPPPPHHQAQHQQPPYLPQQQMP 334

  Fly   426 LSPGGDSPGPS 436
            ..|   :||.|
 Frog   335 RPP---APGMS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 54/85 (64%)
foxj2XP_031760837.1 FH_FOXJ2 68..149 CDD:410825 51/80 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.