DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and fd96Ca

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster


Alignment Length:355 Identity:108/355 - (30%)
Similarity:135/355 - (38%) Gaps:118/355 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 KPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSL 234
            :|.::..|.:||||||.:|..|||..|.||.|.|:.||::|....||||.|.|.||||:|||||.
  Fly     3 RPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSF 67

  Fly   235 NKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPGL 299
            |.||:||||..|.||||.||.|.|.|.|:|..||.  ||||    .|.:|....:.|:......|
  Fly    68 NDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSL--LRRR----KRFKLHKNDKDLLNEELTAL 126

  Fly   300 AAYPQF-------GQFLTYPPTAPSLLASMYQRYNPFAPKG--------GPGHPGLPPGLP---- 345
            |...:|       |......|...:..|:|  |.:|. |:.        |||.| ||..:|    
  Fly   127 ANLNRFFFTTRNGGSAAHMSPLDMNNAAAM--RLDPL-PRSTAHMPNSLGPGVP-LPHVMPASMS 187

  Fly   346 ----------GLPGPPG-----PQGP----------------PGPPPPP---------------- 363
                      ||...|.     .:||                |..|..|                
  Fly   188 GADHTNLADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVV 252

  Fly   364 -------FVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQP-PPTH------ 414
                   :...|.:||.|                        :|.:.:|....| ||.|      
  Fly   253 ECSGISRYPTTPAASEEY------------------------MSASRSSRTEDPLPPMHTINAGA 293

  Fly   415 HHP--HLAVGQ--APLSPGGDSPGPSPQPL 440
            |.|  |.|.|.  |.|...|....|:...|
  Fly   294 HVPFLHYATGANVAGLPASGIPNSPTTYEL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 51/84 (61%)
fd96CaNP_001287516.1 FH 13..101 CDD:214627 52/87 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445529
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.