DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FoxP

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster


Alignment Length:323 Identity:75/323 - (23%)
Similarity:111/323 - (34%) Gaps:153/323 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SPHPVGL---NLTNLMKMARTPHLKSSFSINSILPETVEHHDEDEEEDVEKKSPAKFPPNHNNNN 99
            ||.|:.|   |.|||..:.:..|.|::||||..||..:|....|.::::           |.|  
  Fly   267 SPSPLNLPMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQEI-----------HRN-- 318

  Fly   100 LNTTNWGSPEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAEN 164
                                                        .||.                 
  Fly   319 --------------------------------------------REFY----------------- 322

  Fly   165 KSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIR 229
                      |..:.:||::|.:||..||..|.:|:||||.||.:......|:|.|...|:|:||
  Fly   323 ----------KNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIR 377

  Fly   230 HNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGP 294
            .||||:||||   |:.||  .|::||:|   ::.|:       :||..:..|.|           
  Fly   378 TNLSLHKCFV---RYEDD--FGSFWMVD---DNEFV-------KRRHLSRGRPR----------- 416

  Fly   295 MFPGLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHP--------------GLPPG 343
                           .|.|::           :|.:.:.|.|.|              .||||
  Fly   417 ---------------KYEPSS-----------SPNSCQSGNGVPTDKNPCDNCTQHCTSLPPG 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 37/84 (44%)
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777
FH 328..400 CDD:238016 36/76 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.