DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxc2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_998857.1 Gene:foxc2 / 407875 XenbaseID:XB-GENE-481382 Length:463 Species:Xenopus tropicalis


Alignment Length:331 Identity:101/331 - (30%)
Similarity:140/331 - (42%) Gaps:87/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRH 244
            ||||||.|||.|||:.:.:|::||||||::||...|:||:||||||||||||||||:|||||||.
 Frog    71 KPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRD 135

  Fly   245 YDDPGKGNYWMLDPSAEDVFIGGSTGKLRRR-----TTAASRSRLAAFKRSLIGPMFPGLAAYPQ 304
            ...||||:||.|||.:.::|..||..:.|||     .:.....|:...:..:.||: |.| ..|:
 Frog   136 DKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSREKEDRILKDQGKVQGPI-PSL-ELPK 198

  Fly   305 FGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPG-------------------- 349
            ..:.:.....:|.|  .:..:....:|.||......|..:...|.                    
 Frog   199 HDKKIVIKSESPEL--PVITKVENLSPDGGSAMQDSPRSVASTPSVSTENSIPDQHPASNGFSVE 261

  Fly   350 -----PPGPQGPPGPPPPPFVAPPTSSELYQRL-----QYQQLLHQHAAAAAL-AAHQRQLSVAA 403
                 ...|.|...|.|    |.|..:.:...|     |.|..::..|...:: .:...|.|:.|
 Frog   262 NIMTLRTSPHGDLSPVP----AVPCRTGMVPSLPINYTQTQSSVYSQACTQSMDTSGSYQCSMRA 322

  Fly   404 ASAASQPPPTH--------------------------------------HHPHLAVG---QAP-- 425
            .|..:...|:|                                      ||...|.|   .||  
 Frog   323 MSLYTGDRPSHMCAPSTLEEATSDHHNGTASPLNSMSLGSGQESVLTSSHHQQTATGGQTAAPWY 387

  Fly   426 LSPGGD 431
            |:||.|
 Frog   388 LNPGAD 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 56/84 (67%)
foxc2NP_998857.1 Forkhead 71..156 CDD:306709 56/84 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.