DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxf2a

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001077284.1 Gene:foxf2a / 407681 ZFINID:ZDB-GENE-110407-5 Length:383 Species:Danio rerio


Alignment Length:342 Identity:112/342 - (32%)
Similarity:153/342 - (44%) Gaps:74/342 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 MSPAPVANPNESDP--DEVDEEFVEEDIECDGETTDGDAENKSNDG--KPVKDKKGNEKPPYSYN 186
            :.|.|   |..|.|  :.:...........:..|..|:...|||.|  :|       |||||||.
Zfish    10 LDPPP---PLRSSPASNSMHSALQNTQTVLESTTATGNKGKKSNSGMRRP-------EKPPYSYI 64

  Fly   187 ALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKG 251
            |.|:|||:.|..|||||:.||:::....|::|.:.|||:||:|||||||:||:|:|:....||||
Zfish    65 APIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKG 129

  Fly   252 NYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFK---RSLIGPMFPGLAAYPQFGQFLTYPP 313
            :||.:||.:|.:|..||.    ||.....|.:..|.|   |.:.|..| |.:..||...|.:  |
Zfish   130 HYWTIDPGSEFMFEEGSF----RRRPRGFRRKCQALKPMYRMMNGIGF-GASMLPQNFDFQS--P 187

  Fly   314 TAPSLLASMYQRYN----PFAPKG-GPGHPGLPPG--LPGLPGPPG----------PQGPPGPPP 361
            :|.  ||.....||    ..|.:| ..|:.||..|  :..:....|          ..|..||..
Zfish   188 SAS--LACHANSYNLDMMSNAVQGVHAGYDGLGAGHHVSHMSPSTGSTYMTACQVASNGEYGPDS 250

  Fly   362 --PPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQA 424
              .|..:|||.|         ..|..|:...|.:||      .|:|..|        |:  :.|.
Zfish   251 SNSPLHSPPTMS---------GSLECHSPYGAASAH------GASSGVS--------PY--IKQQ 290

  Fly   425 PLSPGGDSPGPSPQPLH 441
            |||    |..|:...||
Zfish   291 PLS----SSSPTSSGLH 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 46/84 (55%)
foxf2aNP_001077284.1 FH 58..146 CDD:214627 47/87 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.