DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxd1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_998078.2 Gene:foxd1 / 405849 ZFINID:ZDB-GENE-040426-2094 Length:343 Species:Danio rerio


Alignment Length:361 Identity:116/361 - (32%)
Similarity:150/361 - (41%) Gaps:91/361 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SDPDEVDEEFVEEDIECDGETTDGDAENKSN--------------------DGKPVKD------K 175
            ||...:.|   |.||:..||..|||...:|.                    |..|.:|      |
Zfish     8 SDASVLSE---ETDIDVVGEGDDGDGHTRSYVDEVAQMHDEILLNGSPPGVDASPARDPYKPASK 69

  Fly   176 KGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVK 240
            ....||||||.|||.|||.||.:|||||:.|.::|....||||:....||||||||||||.||||
Zfish    70 NTLVKPPYSYIALITMAILQSPKKRLTLSEICDFISNRFPYYREKFPAWQNSIRHNLSLNDCFVK 134

  Fly   241 VPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLI-------GPMFPG 298
            :||...:|||||||.|||.:.|:|..||..:.|:|           |||...       |...|.
Zfish   135 IPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKR-----------FKRQQAPELLREHGGFLPS 188

  Fly   299 LAAYPQ------FG-QFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGP 356
            .|||..      :| |..:|...:..|.....|:..|                     ||.....
Zfish   189 AAAYGYGPYGCGYGLQLQSYHAHSALLAFQQQQQQQP---------------------PPSRNTG 232

  Fly   357 PGPPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAA----HQRQLSVAAASAASQPPPTHHHP 417
            ...|.|..:  ||::||.:...|..|....:::...||    |:...|:.:...:|..|.   |.
Zfish   233 TLIPAPSLM--PTTTELTRSRFYPPLSPGISSSLQTAAKSPVHRSPFSIDSIIGSSLSPT---HS 292

  Fly   418 HLAVGQAPLSP-------GGDSPGPSPQPLHKPVTV 446
            |.|...:|:.|       ...||.|....||.|.::
Zfish   293 HCASRTSPVVPVLPPALAAQHSPNPLLGVLHGPTSL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 54/84 (64%)
foxd1NP_998078.2 Forkhead 74..160 CDD:278670 55/85 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.