DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxq1b

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_998072.1 Gene:foxq1b / 405843 ZFINID:ZDB-GENE-040426-2090 Length:283 Species:Danio rerio


Alignment Length:164 Identity:71/164 - (43%)
Similarity:90/164 - (54%) Gaps:23/164 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 APVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKKG-----NEKPPYSYNAL 188
            |.||:|..:          ||::..||:.    :.|....|.||.|.|.     ..||||||.||
Zfish     3 ANVASPLST----------EEELGSDGDC----SANSPGPGAPVPDGKAKPYTRRPKPPYSYIAL 53

  Fly   189 IMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDP-GKGN 252
            |.||||.|:..||||..|.||:|...|::|.:..||:||:|||||||.||:||.|....| ||.|
Zfish    54 IAMAIRDSNTGRLTLAEINEYLMKKFPFFRGSYTGWRNSVRHNLSLNDCFLKVLRDPSRPWGKDN 118

  Fly   253 YWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAA 286
            ||||:|.:|..|   :.|..|||....|:..|.:
Zfish   119 YWMLNPHSEYTF---ADGVFRRRRKRISKKILGS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 50/85 (59%)
foxq1bNP_998072.1 FH 45..134 CDD:214627 51/91 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.