DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxa4

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_988938.1 Gene:foxa4 / 394535 XenbaseID:XB-GENE-486455 Length:399 Species:Xenopus tropicalis


Alignment Length:201 Identity:71/201 - (35%)
Similarity:100/201 - (49%) Gaps:37/201 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 HNNNNLNTTNWGSPEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTD 159
            ||.||      |.|.:....:|         :|..|.:.|..|:........::.::...|..|.
 Frog    29 HNMNN------GLPSNSFLPTD---------VSTVPTSMPYMSNGLSGPVTSIQGNLGSLGSMTQ 78

  Fly   160 G-------------------DAENK-SNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLN 204
            |                   ..|:: ..|.:..:....:.||||||.:||.|||:|:..|.:|||
 Frog    79 GMVGSLAPPASTPAYPMGYCQGESEFQRDPRTYRRNYSHAKPPYSYISLITMAIQQAPNKMMTLN 143

  Fly   205 GIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGST 269
            .||::|:...||||.|:|.|||||||:||.|.|||||||..:.||||:||.|.|.:.::|..|. 
 Frog   144 EIYQWIIDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPEKPGKGSYWTLHPESGNMFENGC- 207

  Fly   270 GKLRRR 275
             .|||:
 Frog   208 -YLRRQ 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 50/84 (60%)
foxa4NP_988938.1 Forkhead_N <25..118 CDD:369872 16/103 (16%)
COG5025 <118..303 CDD:227358 55/97 (57%)
FH 119..207 CDD:214627 51/87 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..290
HNF_C 326..387 CDD:370449
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.