DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxm1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_957391.1 Gene:foxm1 / 394072 ZFINID:ZDB-GENE-040426-1275 Length:623 Species:Danio rerio


Alignment Length:382 Identity:93/382 - (24%)
Similarity:131/382 - (34%) Gaps:129/382 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KKSPAKFPPNHNNNNLNTTNWGSPEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEE 149
            ||....||.:.:..|:......|.:...:|..|..|            |||:|.......|    
Zfish   125 KKESECFPLDDSLTNIQWLGKMSSDGLGSEKCPNKD------------NPNDSQQQSKGPE---- 173

  Fly   150 DIECDGETTDGDAENKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNH 214
                           |.||       ..:|:|||||.|:|..||...:.:.:||..||.:|..:.
Zfish   174 ---------------KEND-------PHSERPPYSYMAMIQFAINSKNNRHMTLKEIYNWIEDHF 216

  Fly   215 PYYRD-NKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTA 278
            ||:|| .|.||:|||||||||:..|:   |.....||.:||.:.|.|                  
Zfish   217 PYFRDIAKPGWKNSIRHNLSLHDMFI---RETSPDGKISYWTIRPEA------------------ 260

  Fly   279 ASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPSL-LASMYQRYNPFAPKGGPGHPGLPP 342
               :|.....:           .|...|..||  ||.|.: ..:::|:..       .|.|.|..
Zfish   261 ---NRCLTLDQ-----------VYKPLGDPLT--PTCPQIPQVAIHQQQK-------RGAPELKK 302

  Fly   343 GLPGLPGPPGPQGPPGPPPPPFVAP-----------PTSSELYQRLQYQQLLHQHAAAAALAAHQ 396
            .:|.|.|......|..|....::.|           ||||.:                       
Zfish   303 AIPALGGTERKMKPLLPRTDSYLVPIQLPLGQSLFLPTSSPV----------------------- 344

  Fly   397 RQLSVAAASAASQPPPTHHHPHLA--VGQAPLS------PGGDSPGPSPQPLHKPVT 445
             .||....:..|..|.:.....:|  |.|:.||      |.  |.....:|:.:|||
Zfish   345 -SLSTPPQTQNSSTPSSSKRVRIAPKVSQSDLSSVLLCKPA--SQEIKEEPVFQPVT 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 38/85 (45%)
foxm1NP_957391.1 FH 182..256 CDD:238016 36/76 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.