DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxl1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_957278.1 Gene:foxl1 / 393959 ZFINID:ZDB-GENE-040426-1181 Length:363 Species:Danio rerio


Alignment Length:119 Identity:63/119 - (52%)
Similarity:80/119 - (67%) Gaps:9/119 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 EKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPR 243
            :||||||.|||.|||:.:.:||.||:|||::||...|||.|||||||||||||||||.||:||||
Zfish    51 QKPPYSYIALIAMAIKNAPDKRATLSGIYQFIMDRFPYYHDNKQGWQNSIRHNLSLNDCFIKVPR 115

  Fly   244 HYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRR---------TTAASRSRLAAFK 288
            ....||||:||.||....|:|..|:..:.:|:         .....|:|:.:||
Zfish   116 EKGRPGKGSYWTLDTKCLDMFENGNYRRRKRKCRTQDTGDTKVGHKRTRVTSFK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 56/84 (67%)
foxl1NP_957278.1 FH 52..140 CDD:214627 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.