DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxi3a

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_944599.2 Gene:foxi3a / 387257 ZFINID:ZDB-GENE-031126-3 Length:353 Species:Danio rerio


Alignment Length:250 Identity:86/250 - (34%)
Similarity:111/250 - (44%) Gaps:64/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRH 244
            :|||||:|||.|||..:..:||||:.||:|:..|.|:|..:|..||||||||||||.||:||||.
Zfish   116 RPPYSYSALIAMAIHGAPNRRLTLSQIYQYVADNFPFYNKSKASWQNSIRHNLSLNDCFMKVPRD 180

  Fly   245 YDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTT-----------AASRSRLAAFKRSLIGPMFPG 298
            ..||||||||.|||:.|.:|..|:..:.|:|.:           :.|.|.|::       |..|.
Zfish   181 DSDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDSLAEEEGKGYSGSDSALSS-------PKNPS 238

  Fly   299 LAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGP--------PGPQG 355
            .::  :.|........||.|        |.|..:.|....|....|  ||.|        ..|.|
Zfish   239 DSS--ERGNSPISTDQAPCL--------NSFLNQMGDVASGSREAL--LPSPLAVPLSQRSSPTG 291

  Fly   356 PPGPPPPPFVAP--------------------------PTSSELYQRLQYQQLLH 384
            ..|...|....|                          |.||:||..|....||:
Zfish   292 VYGSYSPNATMPQWETQIPQSSISSTPYKDGYSDSMLNPYSSQLYPVLGSSDLLY 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 52/84 (62%)
foxi3aNP_944599.2 FH 116..204 CDD:214627 53/87 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.