DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxi2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_944598.2 Gene:foxi2 / 387256 ZFINID:ZDB-GENE-031126-2 Length:383 Species:Danio rerio


Alignment Length:208 Identity:82/208 - (39%)
Similarity:109/208 - (52%) Gaps:46/208 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRH 244
            :|||||:|||.|||:.:.||:|||:.||:|:..|.|:|:.:|.|||||||||||||.||.||||.
Zfish   129 RPPYSYSALIAMAIQNAHEKKLTLSQIYQYVADNFPFYKKSKAGWQNSIRHNLSLNDCFKKVPRD 193

  Fly   245 YDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRS-----------RLAAFKRS----LIGP 294
            .|||||||||.|||:.|.:|..|:..:.|:|.:.:|..           :||..|.:    |.||
Zfish   194 EDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRSDSSTGVSSNTKPEDDRQLAGIKPTDSPHLTGP 258

  Fly   295 MFP---------------GLAAYPQFGQFL--------TYPPTAP----SLLASMYQR----YNP 328
            ..|               |||:.|.|..|.        :..||:.    .|:..:..|    .:|
Zfish   259 ASPDADAATDSHKGASPAGLASAPCFNNFFNSMSALGSSSTPTSRHGSLGLVNELSSRNISALSP 323

  Fly   329 FAPKGGPGHPGLP 341
            :....||...|.|
Zfish   324 YHASTGPEAGGAP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 55/84 (65%)
foxi2NP_944598.2 Forkhead 129..215 CDD:278670 56/85 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.