DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FoxL1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster


Alignment Length:298 Identity:101/298 - (33%)
Similarity:130/298 - (43%) Gaps:82/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 EKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPR 243
            ||||:||.|||.|||..:..:||||:|||::||...||||:||||||||||||||||.||||:||
  Fly    90 EKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFVKIPR 154

  Fly   244 ------HYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASR-------------------SR 283
                  ..|..|||:|||||.||.|:|   ..|..|||.|...|                   :.
  Fly   155 DKNTIEDNDSAGKGSYWMLDSSASDMF---EQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGNS 216

  Fly   284 LAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPSLLASMYQRY-----------NPFAPKGGPGH 337
            .||..||...|:       ..|..|....|.....:..::::|           |..|       
  Fly   217 SAAEIRSPSEPL-------SDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSLFNNEA------- 267

  Fly   338 PGLPPGLPGLPGPPGPQGPPGPPPPPFVAPPTSSELYQRLQYQQLLHQ--HAAAA-ALAAHQRQL 399
            .||.| ||.:...|..             ...||...:.:|....||:  |:.:| ....::|:.
  Fly   268 RGLRP-LPEIRECPDD-------------VDASSSSSKAMQSSMELHEELHSPSAFTPPLNRRET 318

  Fly   400 SVAAASAASQPPPTHHHPHLAVGQAPLSPGGDSPGPSP 437
            |.:.|            |.||.....:....|:||.||
  Fly   319 SSSGA------------PVLAEAFNGIKDVVDAPGSSP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 58/90 (64%)
FoxL1NP_001246609.1 FH 91..185 CDD:214627 59/96 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445468
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.