DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxl3

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001182057.1 Gene:Foxl3 / 384244 MGIID:3646467 Length:216 Species:Mus musculus


Alignment Length:257 Identity:87/257 - (33%)
Similarity:105/257 - (40%) Gaps:84/257 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 NKSNDGKPV---KDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQ 225
            |...|..|.   .::|...:|.|||.|||.|||:||...|:||:|||::||...||||.|::.||
Mouse    13 NDDADDYPAGSSDEEKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQRAWQ 77

  Fly   226 NSIRHNLSLNKCFVKVPR-HYDDPGKGNYWMLDPSAE---DVFIGGSTGKLRRRTTAASRSRLAA 286
            ||||||||||.||||||| ..:|.||||||......|   |:|..|:..:.|||.          
Mouse    78 NSIRHNLSLNSCFVKVPRTEGNDKGKGNYWTFAGGCESLLDLFENGNFRRRRRRR---------- 132

  Fly   287 FKRSLIGPMFPGLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPP 351
                  ||.                               ...||  ||    |.|...|.|||.
Mouse   133 ------GPK-------------------------------REEAP--GP----LEPTARGSPGPD 154

  Fly   352 GPQGP----------------------PGPPPPPFVAPPTSSE--LYQRLQYQQLLHQHAAA 389
            ..|.|                      ..|.|.|.:.....|:  .|..|:.||:..|..||
Mouse   155 SAQAPDHEAQASPTTHRDIKFSIDYILSSPDPFPTLRSSCHSQEARYPALEPQQMSFQFWAA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 53/88 (60%)
Foxl3NP_001182057.1 Forkhead 32..118 CDD:278670 52/85 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.