DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and fd59A

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster


Alignment Length:204 Identity:80/204 - (39%)
Similarity:108/204 - (52%) Gaps:28/204 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 SDPESDL-DVTSMSPAPV----------------ANPNESDPDEVDEEFVEEDIECD----GETT 158
            :||...| |..|:||..:                |:...:..|.:.....:.|||..    ....
  Fly     5 TDPMHTLHDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGAA 69

  Fly   159 DGDAENKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQG 223
            .|:.:...:.|.|:      .||||||.|||.|||.||..|:|||:||.::||:..|||:|....
  Fly    70 GGNGDGSGSSGGPL------VKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPA 128

  Fly   224 WQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFK 288
            ||||||||||||.||:||||...:|||||:|.|||.|||:|..||..:.|:|...|...:..:|.
  Fly   129 WQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFP 193

  Fly   289 RSLIGPMFP 297
             ::.|.:.|
  Fly   194 -AVFGTLSP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 56/84 (67%)
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 57/85 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445480
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.