DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxc1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_599165.1 Gene:Foxc1 / 364706 RGDID:1589718 Length:553 Species:Rattus norvegicus


Alignment Length:285 Identity:101/285 - (35%)
Similarity:127/285 - (44%) Gaps:63/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 PVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLN 235
            |....|...||||||.|||.|||:.:.:|::||||||::||...|:|||||||||||||||||||
  Rat    69 PQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLN 133

  Fly   236 KCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPGLA 300
            :|||||||....||||:||.|||.:.::|..||..:.|||           ||:.      ..:.
  Rat   134 ECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRR-----------FKKK------DAVK 181

  Fly   301 AYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGPP-------- 357
            ...:.|:.....|..|.              .|....|..|....|  ..||||.||        
  Rat   182 DKEEKGRLHLQEPPPPQ--------------AGRQPAPAPPEQAEG--SAPGPQQPPVRIQDIKT 230

  Fly   358 ----GPPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPH 418
                .|.||..::|..:            |...:||..........|.::.|:.|.||.:     
  Rat   231 ENGTCPSPPQPLSPAAA------------LGSGSAATVPKIESPDSSSSSLSSGSSPPGS----- 278

  Fly   419 LAVGQAPLSPGGDSPGPSPQPLHKP 443
             .....|||.....|.|.|||...|
  Rat   279 -LPSARPLSLDAAEPAPPPQPAPPP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 57/84 (68%)
Foxc1NP_599165.1 FH 78..166 CDD:214627 58/87 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.