DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXK2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_004505.2 Gene:FOXK2 / 3607 HGNCID:6036 Length:660 Species:Homo sapiens


Alignment Length:408 Identity:118/408 - (28%)
Similarity:170/408 - (41%) Gaps:79/408 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EDEEEDVEKKSPAK-FPPNHNNNNLNTTNWGSPEDHEAESDPESDLDVTSMSPAP-----VANPN 135
            |..|:....:||.| ..|:.:...:|.              |::...:.|..|:|     .||..
Human   160 EKREKQEASESPVKAVQPHISPLTINI--------------PDTMAHLISPLPSPTGTISAANSC 210

  Fly   136 ESDPDEVDE------EFVEEDIECDGETTDGDAENKSNDGKPVKDKKGNEKPPYSYNALIMMAIR 194
            .|.|.....      ..:..|:....:.:..:.|.:::.|...||   :.||||||..||:.||.
Human   211 PSSPRGAGSSGYKVGRVMPSDLNLMADNSQPENEKEASGGDSPKD---DSKPPYSYAQLIVQAIT 272

  Fly   195 QSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPS 259
            .:.:|:|||||||.:|..|:||||...:|||||||||||||:.|:||||..::||||::|.:||:
Human   273 MAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPA 337

  Fly   260 AEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPG----LAAYPQFGQFLTYPPTAPSLLA 320
            :|...|..:..|.|.|.....|:.|.... |...|..|.    |:|:....|      |..||  
Human   338 SESKLIEQAFRKRRPRGVPCFRTPLGPLS-SRSAPASPNHAGVLSAHSSGAQ------TPESL-- 393

  Fly   321 SMYQRYNPFAPKGGPGHPGL--------PPGLPGLPGPPGP-------QGPPGPPPPPF-VAPPT 369
            |......|..|:.|...|.|        ....||.|....|       |.|....|..: ||.|.
Human   394 SREGSPAPLEPEPGAAQPKLAVIQEARFAQSAPGSPLSSQPVLITVQRQLPQAIKPVTYTVATPV 458

  Fly   370 SSELYQR--LQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPLSPGGDS 432
            ::...|.  :|...::||..|            |:..|.|...|.   :.:...|||.::|....
Human   459 TTSTSQPPVVQTVHVVHQIPA------------VSVTSVAGLAPA---NTYTVSGQAVVTPAAVL 508

  Fly   433 PGPSPQPL----HKPVTV 446
            ..|..:..    |:.|.|
Human   509 APPKAEAQENGDHREVKV 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 50/84 (60%)
FOXK2NP_004505.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
FHA 47..154 CDD:238017
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..104
Required for interaction with DVL2 and SUDS3. /evidence=ECO:0000269|PubMed:25805136 129..171 2/10 (20%)
COG5025 <180..577 CDD:227358 112/388 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..260 10/59 (17%)
Forkhead 257..343 CDD:365978 50/85 (59%)
DNA-binding, major groove. /evidence=ECO:0000269|PubMed:16624804 300..318 14/17 (82%)
DNA-binding, minor groove. /evidence=ECO:0000269|PubMed:16624804 328..332 2/3 (67%)
DNA-binding, minor groove. /evidence=ECO:0000269|PubMed:16624804 348..353 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..407 14/56 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 610..632
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.