DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXI3

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001129121.1 Gene:FOXI3 / 344167 HGNCID:35123 Length:420 Species:Homo sapiens


Alignment Length:296 Identity:101/296 - (34%)
Similarity:142/296 - (47%) Gaps:71/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRH 244
            :|||||:|||.|||:.:.|::|||:.||:::..:.|:|:.:|.|||||||||||||.||.||||.
Human   145 RPPYSYSALIAMAIQSAPERKLTLSHIYQFVADSFPFYQRSKAGWQNSIRHNLSLNDCFKKVPRD 209

  Fly   245 YDDPGKGNYWMLDPSAEDVFIGGS-TGKLRRRTTAASRSRLAA----FKRSLIGPMFPGLAAYPQ 304
            .|||||||||.|||:.|.:|..|: ..|.:||:.|::.|.:||    .:..|...:..|:...|:
Human   210 EDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRSEASNGSTVAAGTSKSEEGLSSGLGSGVGGKPE 274

  Fly   305 FGQFLTYPPTAPSLLASMYQRYNPFAPKG------GPGHPGL--PPGL----------------- 344
                    ..:||.|  :...::|..|:|      .||.|.|  .|.|                 
Human   275 --------EESPSTL--LRPSHSPEPPEGTKSTASSPGGPMLTSTPCLNTFFSSLSSLSVSSSVS 329

  Fly   345 --PGLPGPP--GPQGPPGPPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAAS 405
              ..|||..  |.||...|....| :|.:.||              |:|..|     |||.:.::
Human   330 TQRALPGSRHLGIQGAQLPSSGVF-SPTSISE--------------ASADTL-----QLSNSTSN 374

  Fly   406 AASQPPPTHHHPHLAVGQAPLSPGGDSPGPSPQPLH 441
            :..| ..:::.|.      |.|..|....|...|.|
Human   375 STGQ-RSSYYSPF------PASTSGGQSSPFSSPFH 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 52/84 (62%)
FOXI3NP_001129121.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..122
Forkhead 145..231 CDD:278670 53/85 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..306 19/81 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..396 9/43 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.