DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and fd19B

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster


Alignment Length:381 Identity:112/381 - (29%)
Similarity:144/381 - (37%) Gaps:151/381 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 MARTPHLKSSFSINSILPETVEHHDEDEEEDVEKKSPAKFPPNHNNNNLNTTNWGSPEDHEAESD 116
            |..||..:|||||.|:|..     |:.||..:.|         ||:                   
  Fly     1 MDTTPIFQSSFSIRSLLSV-----DKKEESPISK---------HNS------------------- 32

  Fly   117 PESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKKGNEKP 181
                                                  |.:....:.:.||........|.|.||
  Fly    33 --------------------------------------GSSFSSCSSSSSNSSSDSMAAKSNAKP 59

  Fly   182 PYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYD 246
            .::|:|||:|||..||||||||:||.::|..|.||||..|..||||||||||||..||:|||..|
  Fly    60 AFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALD 124

  Fly   247 DPGKGNYWMLDPSAEDVFIGGSTGKLRR----RTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQ 307
            |||:|:||.|||.|||:.||.:||:|||    :.|.|.                |.:..:|    
  Fly   125 DPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGAR----------------PKVTGHP---- 169

  Fly   308 FLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPPPFVAPPTSSE 372
                           |||    .|..|.||..                      .|::...::  
  Fly   170 ---------------YQR----MPYYGHGHGN----------------------GPYIKAHSA-- 191

  Fly   373 LYQRLQYQQLL-HQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPLS 427
                  |..:: |||  .||:..|.:    |........|..|||.|....|.|.|
  Fly   192 ------YFPIMDHQH--HAAMVQHYQ----AMMHRYQMMPHPHHHQHQHQHQHPHS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 56/84 (67%)
fd19BNP_608369.1 FH 58..135 CDD:238016 50/76 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471426
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1751
87.750

Return to query results.
Submit another query.