DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXA2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_068556.2 Gene:FOXA2 / 3170 HGNCID:5022 Length:463 Species:Homo sapiens


Alignment Length:372 Identity:116/372 - (31%)
Similarity:151/372 - (40%) Gaps:103/372 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SMSP------------APVANPNESDPDEVDEEFVEEDIECDGETTDGDAE-NKSNDGKPVKDKK 176
            |:||            ||.||.|...|                  ..|.|. :::.|.|..:...
Human   115 SLSPLGGQAAGAMGGLAPYANMNSMSP------------------MYGQAGLSRARDPKTYRRSY 161

  Fly   177 GNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKV 241
            .:.||||||.:||.|||:||..|.|||:.||::||...|:||.|:|.|||||||:||.|.||:||
Human   162 THAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKV 226

  Fly   242 PRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLA---------AFKRSLIGPMFP 297
            ||..|.||||::|.|.|.:.::|..|.  .|||:.......:||         :.|::..|..  
Human   227 PRSPDKPGKGSFWTLHPDSGNMFENGC--YLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGAQ-- 287

  Fly   298 GLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFA--PKGGPGH-PGLPPGL--PGLPGP-PGPQ-- 354
              |:..|.|:........|:...|.:...:|..  .:||.|. .|.|...  |..|.| ||.|  
Human   288 --ASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQ 350

  Fly   355 ------GP---PGPPPPPFVAP--------PTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVA 402
                  ||   ||.||...:.|        |.|   ...|...:..|.|       :|.      
Human   351 AAAHLLGPPHHPGLPPEAHLKPEHHYAFNHPFS---INNLMSSEQQHHH-------SHH------ 399

  Fly   403 AASAASQPPPTHHHPH----LAVGQAPLSPGGDSPGPSPQPLHKPVT 445
                       ||.||    .|..|....||..||.|....: .|||
Human   400 -----------HHQPHKMDLKAYEQVMHYPGYGSPMPGSLAM-GPVT 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 50/84 (60%)
FOXA2NP_068556.2 Forkhead_N 23..164 CDD:369872 13/66 (20%)
FH_FOXA2 163..264 CDD:410813 55/102 (54%)
HNF_C 380..452 CDD:401339 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.