DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXA1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_004487.2 Gene:FOXA1 / 3169 HGNCID:5021 Length:472 Species:Homo sapiens


Alignment Length:274 Identity:97/274 - (35%)
Similarity:120/274 - (43%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 DGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNL 232
            |.|..|....:.||||||.:||.|||:|:..|.|||:.||::||...||||.|:|.|||||||:|
Human   158 DAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSL 222

  Fly   233 SLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFP 297
            |.|.|||||.|..|.||||:||.|.|.:.::|..|.  .|||:.......:..|......|....
Human   223 SFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGC--YLRRQKRFKCEKQPGAGGGGGSGSGGS 285

  Fly   298 GLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPP 362
            |....|:..:    .|:..|         ||.|  ..|.|.|:......|.|.|.| ||...|  
Human   286 GAKGGPESRK----DPSGAS---------NPSA--DSPLHRGVHGKTGQLEGAPAP-GPAASP-- 332

  Fly   363 PFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPLS 427
                             |.|.|..|.|...|:   :|...|:|.|   ||....|. |:...|.|
Human   333 -----------------QTLDHSGATATGGAS---ELKTPASSTA---PPISSGPG-ALASVPAS 373

  Fly   428 PGGDSPGPSPQPLH 441
            .......|....||
Human   374 HPAHGLAPHESQLH 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 51/84 (61%)
FOXA1NP_004487.2 Forkhead_N 17..169 CDD:369872 3/10 (30%)
FH_FOXA1 157..268 CDD:410812 59/111 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..392 38/161 (24%)
HNF_C 398..461 CDD:401339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.