DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxj3

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001101441.1 Gene:Foxj3 / 313554 RGDID:1311770 Length:622 Species:Rattus norvegicus


Alignment Length:373 Identity:97/373 - (26%)
Similarity:142/373 - (38%) Gaps:129/373 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 NKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSI 228
            |.:.|.:.|:..| :.||||||.:||..||..|.:|::||:.||::|..|.||||:...||:|||
  Rat    63 NTTLDQEEVQQHK-DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSI 126

  Fly   229 RHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAE-------------------------------D 262
            ||||||||||:||||..||||||:||.:|.:.:                               :
  Rat   127 RHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDTLPTRPKKRARSVERASTPYSIDSDSLGME 191

  Fly   263 VFIGGS----------TGKLRRRTT--------------AASRSRLAAFKRSLIGPM--FPGLAA 301
            ..|.||          |.|:....|              :.|...||:...:.:|.:  :..:..
  Rat   192 CIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTN 256

  Fly   302 YPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLP------------------------- 341
            :|:        |.:.||......:||            ||                         
  Rat   257 HPE--------PVSQSLTPQQQPQYN------------LPERDKQLLFTEYNFEDLSASFRSLYK 301

  Fly   342 ---------PGLPGLPGPPGPQGPPG-----PPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAAL 392
                     .||..:|.....|....     .|.....:.|.|::       ..|.:.|:..:|.
  Rat   302 SVFEQSLSQQGLMSIPSESSQQSHTSCSYQHSPSSTVTSHPHSNQ-------SSLPNNHSGLSAT 359

  Fly   393 AAHQ-RQLSVAAASAASQPPP-THHHPHLAVGQAPLSPGGDSPGPSPQ 438
            .::. .|:|::.....:||.| |.|.|| .:.|.|..|  ..|...||
  Rat   360 GSNSVAQVSLSHPQMHTQPSPHTPHRPH-GLPQHPQRP--QHPASHPQ 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 50/115 (43%)
Foxj3NP_001101441.1 COG5025 <54..345 CDD:227358 78/302 (26%)
FH_FOXJ3 77..155 CDD:410826 49/77 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.