DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxa3

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_571374.1 Gene:foxa3 / 30559 ZFINID:ZDB-GENE-980526-423 Length:441 Species:Danio rerio


Alignment Length:444 Identity:119/444 - (26%)
Similarity:170/444 - (38%) Gaps:129/444 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PSSEISAHSLHFQHHHHPLPPTTHHSALQSPHP-VGLNLTNLMKMARTPHLKSSFSINSILPETV 72
            ||:..|..||   :.:..|......|::...:| .|||.:.|..|...|:..|...:.|.|    
Zfish    29 PSAMNSVSSL---NSYINLNSACSTSSMNMGYPSAGLNSSPLSSMGGGPNHMSLSPVGSSL---- 86

  Fly    73 EHHDEDEEEDVEKKSPAKFPPNHNNNNLNTTNWGS------PEDH-EAESDPESDLDVTSMSPAP 130
                                     |..:.|..||      |..| ::...|.|.:..    |:|
Zfish    87 -------------------------NPSSLTQLGSSASTLGPLSHYQSMGQPMSQISY----PSP 122

  Fly   131 VA-NPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKKGNEKPPYSYNALIMMAIR 194
            .: |..:..|                              ||.:....:.||||||.:||.|||:
Zfish   123 TSLNRTKEMP------------------------------KPYRRSLTHAKPPYSYISLITMAIQ 157

  Fly   195 QSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPS 259
            ||..|.||||.||::||...||||:|:|.|||||||:||.|.|||||.|..|.||||:||.|.|:
Zfish   158 QSQSKMLTLNEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPN 222

  Fly   260 AEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPSLLASMYQ 324
            :.::|..|...:.::|.....::...:..:|..|....|  .:...|....:.||..|..|.   
Zfish   223 SGNMFENGCYLRRQKRFKIEEKAGKKSSSKSQDGSSTKG--THSSEGMQEEHSPTTGSDGAE--- 282

  Fly   325 RYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPPPFVAPPTSSELYQRLQYQQLLHQHAAA 389
                 :......|.|                             ::||..||...|  |...:.|
Zfish   283 -----SAHSDSSHAG-----------------------------STSEEQQRSLVQ--LDCPSQA 311

  Fly   390 AALAAHQRQLSVAAASAASQPPPTHH-HPHLAVGQAPLSPG-GDSPGPSPQPLH 441
            ..| .|...:.:.::.:||.||.:.| |          |.| |:||.....|:|
Zfish   312 PNL-LHSSPVPIPSSVSASMPPSSSHLH----------SQGMGNSPHLLGSPMH 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 53/84 (63%)
foxa3NP_571374.1 Forkhead_N 17..142 CDD:254796 31/178 (17%)
FH 143..231 CDD:214627 54/87 (62%)
HNF_C 374..>408 CDD:286443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.