DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxd3

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_571365.2 Gene:foxd3 / 30548 ZFINID:ZDB-GENE-980526-143 Length:371 Species:Danio rerio


Alignment Length:363 Identity:130/363 - (35%)
Similarity:162/363 - (44%) Gaps:94/363 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEE--DIEC----DGETTDGDAENKSNDGK 170
            |.:...|.|.|..|..       .:...|||:|..|:|  |..|    ||| |.|||:..|....
Zfish    30 EGDEGMEQDSDCESQC-------MQDRGDEVEEIEVKERSDSPCESNADGE-TKGDAQESSTGPM 86

  Fly   171 PVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLN 235
            ..|.|....||||||.|||.|||.||.:|:|||:||.|:|....||||:....||||||||||||
Zfish    87 QNKPKSSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLN 151

  Fly   236 KCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPGLA 300
            .||||:||...:|||||||.|||.:||:|..||..:.|:|           |||.          
Zfish   152 DCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKR-----------FKRH---------- 195

  Fly   301 AYPQFGQFLTYPPTAPSLL----ASMYQRYNPFAPKGGPGHP-----GLPPG---------LPGL 347
                          .|.:|    |.|.|.:..:    |.|:|     |:.|.         .|.:
Zfish   196 --------------QPDILRDQTALMMQSFGAY----GIGNPYGRHYGIHPAAYTHPAALQYPYI 242

  Fly   348 PGPPGPQGPPGPPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQL-SVAAASAASQPP 411
            | |.||..||..|..|      |:||.::....||      :.:|   |.|| |::.||.....|
Zfish   243 P-PVGPMLPPAVPLLP------SAELNRKAFSSQL------SPSL---QLQLNSLSTASIIKSEP 291

  Fly   412 PTHHHPHLAVGQAPLSPGGDSPGPSPQP-LHKPVTVVS 448
            .:  .|..::...   .|..|...|.|. |..||||.|
Zfish   292 SS--RPSFSIENI---IGVSSSSTSAQTFLRPPVTVQS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 56/84 (67%)
foxd3NP_571365.2 Forkhead 96..182 CDD:278670 57/85 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.