DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxd5

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_571345.1 Gene:foxd5 / 30524 ZFINID:ZDB-GENE-980605-4 Length:321 Species:Danio rerio


Alignment Length:374 Identity:116/374 - (31%)
Similarity:150/374 - (40%) Gaps:117/374 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SPEDHEAE------SDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENK 165
            ||||.|.:      ||.|.:..:             .||.|||.         .|..:.|::|:.
Zfish    16 SPEDDEIDIVGGDHSDSEREYFM-------------RDPTEVDH---------SGSESSGESESD 58

  Fly   166 SNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRH 230
            .........:..:.||||||.|||.|||.||..|:|||:||.::|....|||::....|||||||
Zfish    59 FASSTVAPKQSSSVKPPYSYIALITMAILQSPMKKLTLSGICDFISNKFPYYKEKFPAWQNSIRH 123

  Fly   231 NLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPM 295
            |||||.||:|:||...:|||||||.|||::||:|..||..:.|:|           |||:     
Zfish   124 NLSLNDCFIKIPREPGNPGKGNYWSLDPASEDMFDNGSFLRRRKR-----------FKRN----- 172

  Fly   296 FPGLAAYPQF--GQFLTYPPTAPSLLASMYQRY-NPFAPKGGPGHPGLPPGLPGLPGPPGPQGPP 357
                  .|:|  ...:.|.||.      .|:.| .|:...|.......|.|.  ||.|.|..   
Zfish   173 ------QPEFTKDSLVLYHPTL------SYRAYGRPYCVSGAVPAQTNPVGY--LPVPDGIM--- 220

  Fly   358 GPPPPPFVAPPTSSELYQRLQYQQL---LHQHAAAAALAAHQRQL------SVAAASAASQPPPT 413
              .||||            .|||.:   :|..........|:.|.      |:.|.|..|....:
Zfish   221 --VPPPF------------FQYQTMNIKIHDAPEIQQRPEHKTQRCSFSIDSIMAKSTESSSKSS 271

  Fly   414 HHH------------------PHLAVGQAPLSPGGDSPGPSPQPLHKPV 444
            .||                  |.|.            |.|:..||.|.|
Zfish   272 AHHLTPDYSFVFPRPTTSCVAPSLV------------PVPTRTPLLKTV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 53/84 (63%)
foxd5NP_571345.1 Forkhead 73..159 CDD:278670 54/85 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.